aspose file tools*
The moose likes Meaningless Drivel and the fly likes Introduce thyself....the funny way Big Moose Saloon
  Search | Java FAQ | Recent Topics | Flagged Topics | Hot Topics | Zero Replies
Register / Login
JavaRanch » Java Forums » Other » Meaningless Drivel
Bookmark "Introduce thyself....the funny way" Watch "Introduce thyself....the funny way" New topic
Author

Introduce thyself....the funny way

Monu Tripathi
Rancher

Joined: Oct 12, 2008
Posts: 1369
    
    1

Imagine a meeting, where you are required to introduce yourself..what is the best introduction(humorous) you can think of??

Hi..I am Monu...my hobbies include Snake charming..i brought a snake too; lost it somewhere in the meeting room!

[ December 06, 2008: Message edited by: Monu Tripathi ]
[ December 06, 2008: Message edited by: Bear Bibeault ]

[List of FAQs] | [Android FAQ] | [Samuh Varta]
John Smith
Ranch Hand

Joined: Oct 08, 2001
Posts: 2937
Damn, I am in the wrong meeting room!
Peter Johnson
author
Bartender

Joined: May 14, 2008
Posts: 5827
    
    7

Several years ago I took this class on team building where the instructor, during the typical "introduce yourself" section asked us to also state "If you were and animal, what animal would you be and why?" Of course, other mentioned things like souring eagles, majestic lions and whatnot. Why it was my turn, I simply stated:

I would be a Pikachu because it would competely thrill my daughters!


JBoss In Action
Mandar Khire
Ranch Hand

Joined: Sep 11, 2007
Posts: 492

Hi,My First name is Adolph Blaine Charles David Earl Frederick Gerald Hubert Irvim John Kenneth Loyd Martin Nero Oliver Paul Quincy Randolph Sherman Thomas Uncas Victor Willian Xerxes Yancy Zeus
& last name is
Wolfeschlegelsteinhausenbergerdorffvoralternwarengewissenhaf
tschaferswesenchafewarenwholgepflegeundsorgfaltigkeitbeschut
zenvonangereifenduchihrraubgiriigfeindewelchevorralternzwolf
tausendjahresvorandieerscheinenbanderersteerdeemmeshedrraums
chiffgebrauchlichtalsseinursprungvonkraftgestartseinlangefah
rthinzwischensternartigraumaufdersuchenachdiesternwelshegeha
btbewohnbarplanetenkreisedrehensichundwohinderneurassevanver
standigmenshlichkeittkonntevortpflanzenundsicherfreunanleben
slamdlichfreudeundruhemitnichteinfurchtvorangreifenvonandere
rintlligentgeschopfsvonhinzwischensternartigraum.
I am from
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
& i will explain you in this meeting uses of enzyme which name is
methionylglutaminylarginyltyrosylglutamylserylleucylphenylal
anylalanylglutaminylleucyllysylglutamylarginyllysylglutamylg
lycylalanylphenylalanylvalylprolylphenylalanylvalylthreonyll
eucylglycylaspartylprolylglycylisoleucylglutamylglutaminylse
rylleucyllysylisoleucylaspartylthreonylleucylisoleucylglutam
ylalanylglycylalanylaspartylalanylleucylglutamylleucylglycyl
isoleucylprolylphenylalanylserylaspartylprolylleucylalanylas
partylglycylprolylthreonylisoleucylglutaminylasparaginylalan
ylthreonylleucylarginylalanylphenylalanylalanylalanylglycylv
alylthreonylprolylalanylglutaminylcysteinylphenylalanylgluta
mylmethionylleucylalanylleucylisoleucylarginylglutaminyllysy
lhistidylprolylthreonylisoleucylprolylisoleucylglycylleucyll
eucylmethionyltyrosylalanylasparaginylleucylvalylphenylalany
lasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyl
tyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvaly
laspartylserylvalylleucylvalylalanylaspartylvalylprolylvalyl
glutaminylglutamylserylalanylprolylphenylalanylarginylglutam
inylalanylalanylleucylarginylhistidylasparaginylvalylalanylp
rolylisoleucylphenylalanylisoleucylcysteinylprolylprolylaspa
rtylalanylaspartylaspartylaspartylleucylleucylarginylglutami
nylisoleucylalanylseryltyrosylglycylarginylglycyltyrosylthre
onyltyrosylleucylleucylserylarginylalanylglycylvalylthreonyl
glycylalanylglutamylasparaginylarginylalanylalanylleucylprol
ylleucylasparaginylhistidylleucylvalylalanyllysylleucyllysyl
glutamyltyrosylasparaginylalanylalanylprolylprolylleucylglut
aminylglycylphenylalanylglycylisoleucylserylalanylprolylaspa
rtylglutaminylvalyllysylalanylalanylisoleucylaspartylalanylg
lycylalanylalanylglycylalanylisoleucylserylglycylserylalanyl
isoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhisti
dylasparaginylisoleucylglutamylprolylglutamyllysylmethionyll
eucylalanylalanylleucyllysylvalylphenylalanylvalylglutaminyl
prolylmethionyllysylalanylalanylthreonylarginylserine.


Millions saw the apple fall, but Newton asked why.
Chandra Bhatt
Ranch Hand

Joined: Feb 28, 2007
Posts: 1707
I name is ... You all know my name already so not to tell
I would like to talk about ... (seems all are genius technocrat here so
to name topic would be unfair here.

Purpose of this meeting is to ... Frankly telling is just time pass.
Anyways to make this meeting meaningful I would like to start... Its boring
na?

Ok let me say something... Now I feel bored... Don't you.
But with respect to this meeting... I ought to say something...
But what to say...

Thank You all for your patience. Please mail your feedback so that we could
implement this concept in our ongoing project.



cmbhatt
Doug Slattery
Ranch Hand

Joined: Sep 15, 2007
Posts: 294
Hi. My name is blah blah blah blah.

I hear public speaking is easier when you imagine your audience is in their underwear. I'm glad to see that everyone is wearing clean underwear today.


- Doug
- Nothing is impossible if I'mPossible
Ernest Friedman-Hill
author and iconoclast
Marshal

Joined: Jul 08, 2003
Posts: 24184
    
  34

I often start meetings by shouting

EVERYONE. STOP. TALKING. AND. LISTEN. TO. ME.


[Jess in Action][AskingGoodQuestions]
marc weber
Sheriff

Joined: Aug 31, 2004
Posts: 11343

Uh, I'm just wondering... Why is everyone on third floor naked today?


"We're kind of on the level of crossword puzzle writers... And no one ever goes to them and gives them an award." ~Joe Strummer
sscce.org
Sri Anand
Ranch Hand

Joined: Mar 06, 2005
Posts: 392
oooh gosh i need to sit around you guys today!!!
Akhilesh Trivedi
Ranch Hand

Joined: Jun 22, 2005
Posts: 1526
Dear friends,
I have a good news and a bad news for you all.

The good news is that there is no bad news and the bad news is that there is no good news.

I am a newsteller not news-letter
[ December 10, 2008: Message edited by: Akhilesh Trivedi ]

Keep Smiling Always — My life is smoother when running silent. -paul
[FAQs] [Certification Guides] [The Linux Documentation Project]
marc weber
Sheriff

Joined: Aug 31, 2004
Posts: 11343

Introduce yourself as the person sitting next to you, and then explain that you're clearly "not yourself" today.
Monu Tripathi
Rancher

Joined: Oct 12, 2008
Posts: 1369
    
    1

My name is Gladiator

OR

Distribute printouts of (an essay on) myself and direct them to blogs for further reading..
[ December 11, 2008: Message edited by: Monu Tripathi ]
 
I agree. Here's the link: http://aspose.com/file-tools
 
subject: Introduce thyself....the funny way